<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P145 P145-12 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q Y188L   K20R, V35M, K102R, D123E, I178M, Q197H, I202V, Q207A, R211K, L228H  
>P145-12| E03 | codons 1-229 | clone E03
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRRYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-12| E05 | codons 1-229 | clone E05
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-12| E02 | codons 1-229 | clone E02
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFPVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-12| E04 | codons 1-229 | clone E04
PISPIEAVPVKLKPGMDGPRVKQWPLTKEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-12| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-12| E01 | codons 1-229 | clone E01
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-12| E06 | codons 1-229 | clone E06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-12| E07 | codons 1-229 | clone E07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-12| E08 | codons 1-229 | clone E08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, R41K, L63P, I64V, K70R, V77I  
>P145-12| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-12| E04 | codons 1-99 | clone E04
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P145-12| E03 | codons 1-99 | clone E03
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-12| E01 | codons 1-99 | clone E01
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P145-12| E08 | codons 1-99 | clone E08
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIVGRNLLTQIGCTLNF
>P145-12| E05 | codons 1-99 | clone E05
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-12| E06 | codons 1-99 | clone E06
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-12| E07 | codons 1-99 | clone E07
PQITLWQ*PLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-12| E02 | codons 1-99 | clone E02
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005