<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P145 P145-43 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 19
3 3TC+AZT+EFV+IDV 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q Y188L   V35I, T69E, K102R, V106I, D123E, I178M, V179I, Q197H, I202V, Q207A, R211K, L228H  
>P145-43| F02 | codons 1-229 | clone F02
PISPIETVPVKLKPGMDGPKVKQWPLTEEEIKALMEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQTEPPFHW
>P145-43| F04 | codons 1-229 | clone F04
PISPIETVPVKLEPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-43| F01 | codons 1-229 | clone F01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-43| F03 | codons 1-229 | clone F03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQDPDMII
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-43| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-43| F08 | codons 1-229 | clone F08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKWKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDMVI
YQYMDDLLVGSDLEIGQHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-43| F07 | codons 1-229 | clone F07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-43| F06 | codons 1-229 | clone F06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-43| F05 | codons 1-229 | clone F05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   L10R, K14R, R41K, L63P, I64V, K70R, V77I  
>P145-43| F03 | codons 1-99 | clone F03
PQITLWQRPRVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-43| F02 | codons 1-99 | clone F02
PQITLWQRPRVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-43| F07 | codons 1-99 | clone F07
PQITLWQRPRVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-43| F08 | codons 1-99 | clone F08
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMNLPGKWKPKLIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P145-43| codons 1-99
PQITLWQRPRVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-43| F06 | codons 1-99 | clone F06
PQITLWQRPRVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QTPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-43| F04 | codons 1-99 | clone F04
PQITLWRRPRVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-43| F01 | codons 1-99 | clone F01
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMNLPGKWKPKLIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P145-43| F05 | codons 1-99 | clone F05
P*ITLWQRPRVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005