<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P145 P145-67 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 19
3 3TC+AZT+EFV+IDV 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q Y188L   V35I, T69E, K102W, D123E, K173T, Q174K, I178M, I202V, Q207A, R211K, L228H  
>P145-67| H02 | codons 1-229 | clone H02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEVCTELEKEGKISKIGPENPYNTPI
FAIKKKDSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKWKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDMVI
YQYMDDLLVGSDLEIGQHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-67| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKWKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDMVI
YQYMDDLLVGSDLEIGQHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-67| H05 | codons 1-229 | clone H05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKGTQDFWEVQLGIPHPAGLKWKKSVTVLDVGDAHFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRTKNPDMVI
YQYMDDLLVGSDLEIGQHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-67| H08 | codons 1-229 | clone H08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKWKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLLVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   K14R, R41K, L63P, I64V, K70R, V77I  
>P145-67| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P145-67| H02 | codons 1-99 | clone H02
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNVIGRNLLTKIGCTLNF
>P145-67| H05 | codons 1-99 | clone H05
PQITLWQRPRVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNPMTQLGCTLNF
>P145-67| H08 | codons 1-99 | clone H08
PQITLWQRPLVTIRIGGQLKEALIDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPVEICGHRAICTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005