<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P145 P145-0 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q     K20R, V35I, D123E, I178M, Q197H, I202V, Q207A, R211K, L228H  
>P145-0| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-0| H01 | codons 1-229 | clone H01
PISPIETVPVKLKPGIDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-0| H10 | codons 1-229 | clone H10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-0| H07 | codons 1-229 | clone H07
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQNFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGHHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-0| H02 | codons 1-229 | clone H02
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGHHRTKIEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-0| H12 | codons 1-229 | clone H12
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTGLEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGHHRTKIEELRAHLLKWGFFTPDQKHQKEPPFHW
>P145-0| H06 | codons 1-229 | clone H06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKVEELRAHLLKWGFFTPDQKHQKEPPFHW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, R41K, L63P, I64V, K70R  
>P145-0| H01 | codons 1-99 | clone H01
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P145-0| H10 | codons 1-99 | clone H10
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P145-0| H07 | codons 1-99 | clone H07
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P145-0| H02 | codons 1-99 | clone H02
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P145-0| H12 | codons 1-99 | clone H12
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P145-0| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P145-0| H06 | codons 1-99 | clone H06
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005