<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P144 P144-16 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K103N   T39A, K49R, V60I, A98S, D123E, A158S, S162D, K166R, R211K  
>P144-16| D02 | codons 1-229 | clone D02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEVCAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGMPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQDSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-16| G04 | codons 1-229 | clone G04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTTPSINNETPGIRYQYNVLPQGWKGSPSIFQDSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-16| D07 | codons 1-229 | clone D07
PISPIETVPVKLKPGMDGPKVKQWSLTEEKIKALVEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVSVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPSIFQDSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-16| D03 | codons 1-229 | clone D03
PISPIKTVPVKLRPGMDGPKVKQWPLTEEKIKALVKICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNRRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQDSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-16| D09 | codons 1-229 | clone D09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPRPSGLKKNKSVTVLDVGDAYFSVPL
DKELRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPSIFQDSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-16| G11 | codons 1-229 | clone G11
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPSIFQGSMTKILEPFRKQNPDIII
YQYVNDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-16| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQDSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-16| G10 | codons 1-229 | clone G10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAESEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPSIFQDSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIGELRQHLWKWGFYTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I  
>P144-16| D09 | codons 1-99 | clone D09
PQITLWRRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-16| D03 | codons 1-99 | clone D03
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEGMNLPGRWKPKMIGGIGSFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-16| G11 | codons 1-99 | clone G11
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-16| D02 | codons 1-99 | clone D02
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-16| G04 | codons 1-99 | clone G04
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-16| D07 | codons 1-99 | clone D07
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-16| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-16| G10 | codons 1-99 | clone G10
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005