<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P144 P144-0 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       T39S, K49R, V60I, D123E, A158S, K166I, V179I, R211K  
>P144-0| E03 | codons 1-229 | clone E03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEKEGKISRIGPEYPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTIILEPFRKQNPDIII
YQYVDDLYVGSDLETGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P144-0| F02 | codons 1-229 | clone F02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRGLNRRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTALTIPSVNNETPGIRYQYNVLPQGWKGSPSIFQDSMTRILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-0| F01 | codons 1-229 | clone F01
PISPIETVPVKLKPGMNGPKVKQWPLTEEKIKTLVEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTIILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-0| F04 | codons 1-229 | clone F04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEKEGEISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTIILEPSRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-0| F06 | codons 1-229 | clone F06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEKEGKISRIGPENPYNTPI
FAIKKKNGDKWRKLVDFRELNKRTQDSWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTIILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKYQKEPPFLW
>P144-0| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTIILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-0| E07 | codons 1-229 | clone E07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTIILEPFRKQNPDITI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P144-0| F03 | codons 1-229 | clone F03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTIILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRHHLWKWGFYTPDKKHQKEPPFLW
>P144-0| F05 | codons 1-229 | clone F05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGILHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQDSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I  
>P144-0| F03 | codons 1-99 | clone F03
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-0| F01 | codons 1-99 | clone F01
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-0| F02 | codons 1-99 | clone F02
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-0| E03 | codons 1-99 | clone E03
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-0| E07 | codons 1-99 | clone E07
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-0| F04 | codons 1-99 | clone F04
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-0| F06 | codons 1-99 | clone F06
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-0| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P144-0| F05 | codons 1-99 | clone F05
PQITLWQRPLVIIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005