<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P138 P138-79 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 32
3 3TC+AZT+EFV+IDV 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   K103N V108I K122E, I135T, E224D  
>P138-79| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P138-79| C03 | codons 1-229 | clone C03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P138-79| C02 | codons 1-229 | clone C02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P138-79| C01 | codons 1-229 | clone C01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWRGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P138-79| C07 | codons 1-229 | clone C07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPS
DEDFRKYTAFTIPSTNNGTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P138-79| C08 | codons 1-229 | clone C08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKPNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P138-79| C05 | codons 1-229 | clone C05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGSKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P138-79| C06 | codons 1-229 | clone C06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P138-79| C04 | codons 1-229 | clone C04
PISPIETVPVKLKPGVDGPKVKQWPLTEEKIKALVKICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTRWRKLVDFRELNKRTQDFWEAQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M N88D I13V, L63P, A71T  
>P138-79| C02 | codons 1-99 | clone C02
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF
>P138-79| C08 | codons 1-99 | clone C08
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF
>P138-79| C03 | codons 1-99 | clone C03
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIEVRQYD
QIPIEICGHKTIGTVLVGPTPVDIIGRDLMTQIGCTLNF
>P138-79| C05 | codons 1-99 | clone C05
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKTIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF
>P138-79| C01 | codons 1-99 | clone C01
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF
>P138-79| C07 | codons 1-99 | clone C07
PLITLWQRPIVTVKVGGQLMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKIIGTVLVGPTPVNIIGRDLMTQIGCTLNF
>P138-79| C06 | codons 1-99 | clone C06
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF
>P138-79| C04 | codons 1-99 | clone C04
PQITLWQRPIVTVKVGGQLMEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF
>P138-79| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005