<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P132 P132-6 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q K103N V108I K20R, K102R, K122E, D123E, I132V, I135T, G196E  
>P132-6| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTRDFWEVQLGIPHPAGLEKSKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDTVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGFFTPDQKHQKEPPFLW
>P132-6| G03 | codons 1-229 | clone G03
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTILDVGDAYFSVPL
DEEFRKYTAFTVPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>P132-6| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQCVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>P132-6| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTILDVGDAYFSVPL
DEEFRKYTAFTVPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>P132-6| G01 | codons 1-229 | clone G01
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTILDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>P132-6| C04 | codons 1-229 | clone C04
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPDNPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTILDVGDAYFSAPL
DEEFRKYTAFTVPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEEPRQHLLRWGFFTPDQKHQKEPPFLW
>P132-6| C08 | codons 1-229 | clone C08
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTILDVGDAYFSVPL
DEEFRKYTAFTVPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELGQHLLRWGFFTPDQKHQKEPPFLW
>P132-6| G08 | codons 1-229 | clone G08
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTILDVGDAYFSVPL
DEEFRKYTAFTVPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>P132-6| G05 | codons 1-229 | clone G05
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12I, I13V, G16E, M36I, I62V, L63A  
>P132-6| codons 1-99
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-6| G08 | codons 1-99 | clone G08
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-6| G01 | codons 1-99 | clone G01
PQITLWRRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLDF
>P132-6| G02 | codons 1-99 | clone G02
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-6| C08 | codons 1-99 | clone C08
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-6| C04 | codons 1-99 | clone C04
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-6| G06 | codons 1-99 | clone G06
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-6| G05 | codons 1-99 | clone G05
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-6| G03 | codons 1-99 | clone G03
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTRIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005