<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P132 P132-49 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 23
3 3TC+AZT+EFV+IDV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q L100I, K103N   K20R, E28K, K102R, K122E, D123E, I135T, G196E, L228H  
>P132-49| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-49| A07 | codons 1-229 | clone A07
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-49| A01 | codons 1-229 | clone A01
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKRQKEPPFHW
>P132-49| A05 | codons 1-229 | clone A05
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-49| A02 | codons 1-229 | clone A02
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALVEICTEMEKEGEISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-49| A03 | codons 1-229 | clone A03
PISPVETVPVKLKPGMDGPRVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAVFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-49| A06 | codons 1-229 | clone A06
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFGELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-49| A08 | codons 1-229 | clone A08
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYIGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I   L10I, T12I, I13V, G16E, M36I, I62V, L63A, A71V  
>P132-49| codons 1-99
PQITLWQRPIVIVKIEGQLKEALLDTGADDTILEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-49| A08 | codons 1-99 | clone A08
PQITLWQRPIVIVKIEGQLKEALLDTGADDTILEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEFCGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-49| A02 | codons 1-99 | clone A02
PQITLWQRPIVIVKIEGQLKEALLDTGADDTILEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEFCGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-49| A07 | codons 1-99 | clone A07
PQITLWQRPIVIVKIEGQLKEALLDTGADDTILEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P132-49| A03 | codons 1-99 | clone A03
PQITLWQRPIVIVKIEGQLKEALLDTGADDTILEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEFCGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-49| A05 | codons 1-99 | clone A05
PQITLWQRPIVTVKIEGQLKEALLDTGADDTIIEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P132-49| A01 | codons 1-99 | clone A01
PQITLWQRPIVIVKIEGQLKEALLDTGADDTILEEINLPGRWKPKMVGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P132-49| A06 | codons 1-99 | clone A06
PQITLWQRPIVIVKIEGQLKEALLDTGADDTILEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005