<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, E36A, T39E, E40ED, S48T, V60I, D121Y, K122E, D123E, I135V, T165I, K173A, D177E, T200A, Q207E, V245Q  
>A276| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, M36I, N37K, R41N, L63P, H69K, L89IM, I93L  
>A276| codons 1-99
PQITLWQRPLVSIKVGGQVKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
van Zyl, GU Antiretroviral resistance patterns and factors associated with resistance in adult patients failing NNRTI-based regimens in the western cape, South Africa. J Med Virol, 2011