<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q K103N A98G, P225H K20R, K43KR, K122E, D123N, I135T, T139V, K173E, I178M, R211K, F214L  
>A265| codons 1-262
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEREGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNEVPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLFTPDQKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, V77I, I93L  
>A265| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
van Zyl, GU Antiretroviral resistance patterns and factors associated with resistance in adult patients failing NNRTI-based regimens in the western cape, South Africa. J Med Virol, 2011