<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P122 P122-31 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   K103N P225H K20R, F214L  
>P122-31| H09 | codons 1-229 | clone H09
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEHPFLW
>P122-31| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEHPFLW
>P122-31| H06 | codons 1-229 | clone H06
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEHPFLW
>P122-31| H11 | codons 1-229 | clone H11
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLNKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEHPFLW
>P122-31| H10 | codons 1-229 | clone H10
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETSGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEHPFLW
>P122-31| H04 | codons 1-229 | clone H04
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLNKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>P122-31| H05 | codons 1-229 | clone H05
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSNMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEHPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14R, I62V, L63S, H69R, V77I P39I
>P122-31| codons 1-99
PQITLWQRPLVSIRIGGQLKEALLDTGADDTVLEEMNLIGRWKPKMIGGIGGFIKVRQYD
QVSIEICGRKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P122-31| H06 | codons 1-99 | clone H06
PQITLWQRPLVSIRIGGQLKEALLDTGAGDTVLEEMNLIGRWKPKMIGGIGGFIKVRQYD
QVSIEICGRKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P122-31| H05 | codons 1-99 | clone H05
PQITLWQRPLVSIRIGGQLKEALLDTGADDTVLEEMNLAGRWKPKMIGGIGGFIKVRQYD
QVTIEICGRKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P122-31| H11 | codons 1-99 | clone H11
PQITLWQRPLVSIRIGGQLKEALLDTGADDTVLEEMNLIGRWKPKMIGGIGGFIKVRQYD
QVSIEICGRKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P122-31| H09 | codons 1-99 | clone H09
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVLEEMDLTGRWKPKMIGGIGGFIKVRQYD
QVTIEICGRKAIGTVLIGPTPVNIIRRNLLTQIGCTLNF
>P122-31| H04 | codons 1-99 | clone H04
PQITLWQRPLVSIRIGGQLKEALLDTGADDTVLEEMNLIGRWKPKMIGGIGGFIKVRQYD
QVSIEICGRKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P122-31| H10 | codons 1-99 | clone H10
PQITLWQRPLVSIRIGGQLKEALLDTGADDTVLEEMNLTGRWKPKMIGGIGGFIKVRQYD
QVTIEICGRKAIGTILIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005