<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HIV104220 HIV104220 Kenya 2009 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N K238T K20KR, V35T, T39TA, K43R, V60I, T69TN, V90I, I94L, D121H, K122E, D123S, I135T, S162D, E169EA, K173S, Q174K, N175Y, D177E, V179T, T200E, K201KR, E203K, Q207A, R211S, H221HY, L228LH, V245I, D250E, K281R, T286A, E291D, V292I, I293V, P294T, E312N  
>HIV104220| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAEMEREGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEIQLGLPHPAGLKKNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILAPFRSKYPEITI
YQYVDDLYVGSDLEIGQHRERIKELRAHLLSWGFTTPDQKYQKEPPFHWMGYELHPDTWT
VQPIILPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKNPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, E35D, M36I, N37D, R41K, R57RK, D60DE, L63M, H69K, L89M  
>HIV104220| codons 1-99
PQITLWQRPLVTVRVGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYE
QIMIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Sigaloff, KC Unnecessary antiretroviral treatment switches and accumulation of HIV resistance mutations; two arguments for viral load monitoring in Africa. JAIDS, 2011