<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P117 P117-24 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E     K64R, V90I, D123E, I135V, I142V, S162A, R211K  
>P117-24| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFLW
>P117-24| C01 | codons 1-229 | clone C01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNNTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQRRTKIEELRQHLLKWGFFTPDEKHQKEPPFLW
>P117-24| C02 | codons 1-229 | clone C02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFLW
>P117-24| C03 | codons 1-229 | clone C03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFLW
>P117-24| C04 | codons 1-229 | clone C04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTRWRKLVDFRELNKRTQDFWEIQLGILHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDKKHQKEPPFLW
>P117-24| C05 | codons 1-229 | clone C05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFLW
>P117-24| C07 | codons 1-229 | clone C07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTTILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, L63S, V77I  
>P117-24| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P117-24| C01 | codons 1-99 | clone C01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P117-24| C02 | codons 1-99 | clone C02
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P117-24| C07 | codons 1-99 | clone C07
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P117-24| C05 | codons 1-99 | clone C05
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P117-24| C04 | codons 1-99 | clone C04
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P117-24| C03 | codons 1-99 | clone C03
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005