<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P115 P115-20 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   K103N   P4S, V10A, E42K, K101Q, I135V, G196E, R211G E29K
>P115-20| codons 1-229
PISSIETVPAKLKPGMDGPKVKQWPLTEKKIKALVEICTEMKKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLW
>P115-20| G05 | codons 1-229 | clone G05
PISSIETVPAKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLW
>P115-20| G04 | codons 1-229 | clone G04
PISSIETVPAKLKPGMDGPKVKQWPLTEKKIKALVEICTEMKKEGKISKIGPENPYNTPV
FAIKKKDSTR*KKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, M36V, N37H, L63R, K70E  
>P115-20| G04 | codons 1-99 | clone G04
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEVHLPGRWKPKMIGGIGGFIKVRQYD
QIRIEICGQEAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P115-20| G05 | codons 1-99 | clone G05
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVRQYD
QIRIEICGHEAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P115-20| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEVHLPGRWKPKMIGGIGGFIKVRQYD
QIRIEICGHEAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005