<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HIV102181 HIV102181 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E K103N A98G, V108I P4S, V35T, T39K, S48T, T69TN, W88C, V118I, K122E, D123E, D177E, I178L, T200E, K201R, E203D, E204K, Q207E, R211K, F214L, V245Q, A272P, T286TA, E291D, V292I, I293V H96Y
>HIV102181| codons 1-308
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKITKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFCEVQLGIPYPGGLKKNKSVTILDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRERIDKLREHLLKWGLFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENRE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, G16E, L19I, E35D, N37H, L63A, H69K, V82I, L89M, I93L  
>HIV102181| codons 1-99
PQITLWQRPLVSIKIEGQIKEALLDTGADDTVLEDMHLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Unnecessary antiretroviral treatment switches and accumulation of HIV resistance mutations; two arguments for viral load monitoring in Africa. JAIDS, 2011