<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P115 P115-2 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       V10A, K11R, V90I, I135V, G196E, R211G E29G
>P115-2| codons 1-229
PISPIETVPARLKPGMDGPKVKQWPLTEGKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLW
>P115-2| A04 | codons 1-229 | clone A04
PISPIETVPARLKPGMDGPKVKQWPLTEGKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    V11A, L19I, N37H, L63R, K70E  
>P115-2| codons 1-99
PQITLWQRPLATIKIGGQIKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVRQYD
QIRIEICGHEAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P115-2| A04 | codons 1-99 | clone A04
PQITLWQRPLATIKIGGQIKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVRQYD
QIRIEICGHEAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005