<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P114 P114-59 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 59

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H K20R, D86E, I135V, S162C  
>P114-59| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P114-59| F02 | codons 1-229 | clone F02
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P114-59| F03 | codons 1-229 | clone F03
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P114-59| F05 | codons 1-229 | clone F05
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGHHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P114-59| F09 | codons 1-229 | clone F09
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P114-59| F06 | codons 1-229 | clone F06
PISPIETVPVKLKPGMDGPRAKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P114-59| F07 | codons 1-229 | clone F07
PISPVETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P114-59| F08 | codons 1-229 | clone F08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQ*VDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P114-59| F04 | codons 1-229 | clone F04
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFREVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHRKEHPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, E35D, N37S, R41K, I93L  
>P114-59| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P114-59| F07 | codons 1-99 | clone F07
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P114-59| F06 | codons 1-99 | clone F06
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P114-59| F05 | codons 1-99 | clone F05
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVKQYN
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P114-59| F03 | codons 1-99 | clone F03
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P114-59| F02 | codons 1-99 | clone F02
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P114-59| F09 | codons 1-99 | clone F09
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P114-59| F08 | codons 1-99 | clone F08
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P114-59| F04 | codons 1-99 | clone F04
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005