<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P113 P113-20 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   Y188L   D123E, I135T, S162C, D177E, Q207E K82E, V111A, F130S, W153R, H221R
>P113-20| B01 | codons 1-229 | clone B01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNERTQDFWEVQLGIPHPAGLKKKKSVTVLDAGDAYFSVPL
DKEFRKYTASTIPSTNNETPGIRYQYNVLPQGRKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLLVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKRQKEPPFLW
>P113-20| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNERTQDFWEVQLGIPHPAGLKKKKSVTVLDAGDAYFSVPL
DKEFRKYTASTIPSTNNETPGIRYQYNVLPQGRKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLLVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKRQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, I93L  
>P113-20| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P113-20| B01 | codons 1-99 | clone B01
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005