<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GT0044838 GT0044838_2 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36L, R41P, D60E, I62V, L63P, I64M, H69K, L89M, I93L  
>GT0044838_2| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEELNLPGPWKPKMIGGIGGFIKVRQYE
QVPMEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E, V106M, G190A   P4S, K20R, V35T, T39E, S48T, A98S, K122E, D123N, E138A, I142V, E169Q, K173A, Q174K, T200A, I202V, Q207N, R211K, F214L, P243T, V245Q, A272P, K277R, Q278H, T286A, E291D, V292I, I293V, E297A, I326V, I329V, Q334H, G335D, Y342F, Q343K  
>GT0044838_2| codons 1-345
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLEKKKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQSSMTKILQPFRAKNPDIVI
YQYMDDLYVASDLEIGQHRAKVEELRNHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEVQKQGHDQWTYQIFKEP

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011