<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P111 P111-71 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 48
3 3TC+AZT+EFV+IDV 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    L100I, K103N   D121H, K122E, I135M, I142V, T200A, E203D  
>P111-71| H10 | codons 1-229 | clone H10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQQLLRWGFTTPDKKHQKEPPFLW
>P111-71| H05 | codons 1-229 | clone H05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSMNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQHLLRWGFTTPDKKHQKEPPFLW
>P111-71| H08 | codons 1-229 | clone H08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTALTIPSMNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQHLLRWGFTTPDKKHQKEPPFLW
>P111-71| H11 | codons 1-229 | clone H11
PISPIETVPVKLKPGMDGPKVKQWPLTEGKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKRRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQHLLRWGFTTPDKKHQKEHPFLW
>P111-71| H12 | codons 1-229 | clone H12
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FTIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQQLLRWGFTTPDKKHQKEPPFLW
>P111-71| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A L24I I15V, L19I, E35D, N37D, I64V, K70R  
>P111-71| H10 | codons 1-99 | clone H10
PQITLWQRPLVTIKVGGQIKEALIDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHRAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P111-71| H11 | codons 1-99 | clone H11
PQITLWQRPLVTIKVGGQIKEALIDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHRAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P111-71| H05 | codons 1-99 | clone H05
PQITLWQRPLVTIKVGGQIKEALIDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHRAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P111-71| H12 | codons 1-99 | clone H12
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P111-71| H08 | codons 1-99 | clone H08
PQITLWQRPLVTIKVGGQIKEALIDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHRAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P111-71| codons 1-99
PQITLWQRPLVTIKVGGQIKEALIDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHRAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005