<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, K70E, M184V K219KQ K103S, V106M   E6K, K20KR, K32R, V35K, T39E, S48T, K102R, K122E, S162C, K173A, D177E, I178L, T200A, E204K, Q207D, R211K, L228R, V245Q, D250E, S251N, A272P, E291D, V292I, I293V  
>GT00411974| codons 1-305
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIRALKEICEEMEKEGKITKIGPENPYNTPV
FAIKRKDSTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRSKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAQNPELVI
YQYVDDLYVGSDLEIGQHRAKIEKLRDHLLKWGFTTPDQKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKENWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4X, L5F, T12X, I15V, L19I, E35D, N37T, R41K, H69K, T74S, L89M, I93L  
>GT00411974| codons 1-99
PQIXFWQRPLVXIKVGGQIKEALLDTGADDTVLEDMTLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011