<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, M36I, N37E, P39Q, R41K, K43KR, I62V, H69K, A71T, I93L  
>GT00366729_1| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEEIELQGKWRPKMIGGIGGFIKVRQYD
QVLIEICGKKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N K238T E28A, V35T, T39E, S48T, K122KE, K173A, D177E, T200A, I202V, Q207K, R211K, L228R, P243T, V245Q, A272P, K275R, K277R, Q278S, T286A, E291D, V292I, I293V, E297EK  
>GT00366729_1| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELRKHLLKWGFTTPDKKHQKEPPFRWMGYELHPDTWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRSLCKLLRGAKALTDIVPLTKEAE
LELAENREILKEPV

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011