<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F   K101E, V106M, G190A   V35T, T39E, K43R, S48T, V60I, K122E, I135IK, K173A, D177E, I178M, T200A, Q207E, V245Q, A272P, Q278QH, R284RG, E291D, V292I, I293V, V317A V254VA, K281*R
>GT00349623| codons 1-322
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEREGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEMVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTANDIQKLVGKLNWASQIYPGIKVKHLCRLLGGTKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19V, M36I, R41K, L63V, H69K, V82I, L89M, I93L  
>GT00349623| codons 1-99
PQITLWQRPLVTIRVGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011