<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R   V106M, G190A   I5V, V35T, T39E, S48T, V60I, S68G, K122E, D123G, S134N, I135V, S162C, K173T, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, E297Q  
>GT00308796_1| codons 1-324
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKITKIGPENPYNTPI
FAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEGFRKYTAFTIPNVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTQNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTQEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, M36I, R41K, L63P, H69K, K70R, L89M, I93L  
>GT00308796_1| codons 1-99
PQITLWQRPLVSIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011