<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GT00258683 GT00258683_1 South Africa 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, E36A, T39E, S48T, S162A, K173T, Q174K, D177DE, I178IM, Q207E, R211K, P243T, V245Q, A272P, K275R, Q278H, T286A, E291D, V292I, I293V, P294T  
>GT00258683_1| codons 1-332
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13X, L19T, K20R, M36I, R41K, L63V, H69K, L89M, I93L  
>GT00258683_1| codons 1-99
PQITLWQRPLVTXKIGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011