<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V21VI, V35T, E36A, T39E, S48T, L100X, D121Y, K122E, I159IV, T165TI, K173T, Q174K, D177E, I178IM, T200A, Q207E, R211K, V245Q, A272P, K277KR, T286A, E291D, V292I, I293V, R307RK, V317A E79K
>GT00235354| codons 1-324
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRKLNKRTQDFWEVQLGIPHPAGXKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAVFQSSMIKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENKEILKEPVHGAYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, M36IL, R41K, R57RK, L63LPS, H69K, L89M, I93L  
>GT00235354| codons 19-99
IKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVKQYDQISIEICGKKAIGTVLVG
PTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011