<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108I P4H, V35T, T39E, S48T, K122E, D123S, S162C, K166R, K173A, D177E, T200A, Q207E, R211K, D218E, V245Q, A272P, C280*, T286A, E291D, V292I, I293V  
>GT00201512_2| codons 1-303
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPEKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL*KLLRGAKALTDIVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5LF, I15V, L19I, K20R, M36I, R41K, L63V, I64M, H69K, V77I, V82I, L89M, I93L L23F
>GT00201512_2| codons 1-99
PQITFWQRPLVTIKVGGQIREAFLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVMEICGKKAIGTVLIGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011