<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V K219Q K103N Y318F V35T, T39E, S48T, V60I, K122E, D123S, I135L, E138A, K173A, I178L, T200A, Q207T, R211K, V245Q, I257IL, A272P, T286A, E291D, I293V, L295I, E308D I309~
>GT00011000_2| codons 1-327
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPDLVI
YQYVDDLYVGSDLEIGQHRAKIEELRTHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVPITEEAE
LELAENRD~LKEPVHGVFYDPSKDLIA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L10F T12S, I15V, L19I, E35D, M36I, R41K, L63P, H69K, L89M, I93L  
>GT00011000_2| codons 1-99
PQITLWQRPFVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGKKAIGTVLVGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011