<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y   K103N   V35T, T39AE, E42EK, S48T, V60I, D76X, K101Q, K122E, D123S, I135L, E138A, K173A, I178L, T200A, Q207K, R211K, V245Q, A272P, E291D, I293V, E308X R172RM, S191Y
>GT00011000_1| codons 1-313
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELKKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVXFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFMAQNPDLVI
YQYVDDLYVGYDLEIGQHRAKIEELRKHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVPLTEEAE
LELAENRXILKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  M46KT L19I, E35D, M36I, R41K, L63P, H69K, L89M, I93L Q18A, L38*S
>GT00011000_1| codons 17-99
GAIKEALLDTGADDTVLEDINSPGKWKPKTIGGIGGFIKVRQYDQIPIEICGKKAIGTVL
VGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Sigaloff, KC Accumulation of HIV drug resistance mutations in patients failing first-line antiretroviral treatment in South Africa. ARHR, 2011