<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101P, K103N V108I V60I, K122E, I135V, T139M, S162G, R211K, F214L, V245E, D250E, A272P, K277R, I293V, E297A, I329L, Q334E, M357T, A376S, K390R, A400T  
>9| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSVNNEMPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGEGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWET

References
Author Title Citation
Kagan, RM Additional HIV-1 mutation patterns associated with reduced phenotypic susceptibility to etravirine in clinical samples. AIDS, 2009