<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P108 P108-0 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W T215D     T7P, V60I, S68G, Q207E, R211K  
>P108-0| F04 | codons 1-229 | clone F04
PTSPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQGFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFDTPDKKHQKEPPFLW
>P108-0| F02 | codons 1-229 | clone F02
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFGELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFDTPDKKHQKEPPFLW
>P108-0| F01 | codons 1-229 | clone F01
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISNIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFSTPDKKHQKEPPFLW
>P108-0| F05 | codons 1-229 | clone F05
PISPIEPVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRELVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFDTPDKKHQKEPPFLW
>P108-0| F08 | codons 1-229 | clone F08
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFDTPDKKHQKEPPFLW
>P108-0| F07 | codons 1-229 | clone F07
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSISNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFDTPDKKHQKEPPFLW
>P108-0| F06 | codons 1-229 | clone F06
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFDTPDKKHQKEPPFLW
>P108-0| codons 1-229
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFDTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, R41K, R57K, L63P  
>P108-0| F05 | codons 1-99 | clone F05
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P108-0| F02 | codons 1-99 | clone F02
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLAQIGCTLNF
>P108-0| F01 | codons 1-99 | clone F01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P108-0| F08 | codons 1-99 | clone F08
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P108-0| F07 | codons 1-99 | clone F07
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P108-0| F04 | codons 1-99 | clone F04
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P108-0| F06 | codons 1-99 | clone F06
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P108-0| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005