<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P102 P102-22 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   L100I, K103N   K20R, K43Q, E44D, V118I, D123E, I135T, Y146H, D177E, G196E, E203K, Q207E, R211Q N57S
>P102-22| G10 | codons 1-229 | clone G10
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYSTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQHNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIKELREHLWQWGFYTPDKKHQKEPPFLW
>P102-22| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYSTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQHNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIKELREHLWQWGFYTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, L19P, N37H, R41K, L63T, I64V, I85T, I93L  
>P102-22| G10 | codons 1-99 | clone G10
PQITLWQRPIVTIKIGGQPKEALLDTGADDTVLEEMHLPGKWKPKMIGGIGGFIKVRQYD
QITVEICGHKAIGTVLVGPTPVNITGRNLLTQLGCTLNF
>P102-22| codons 1-99
PQITLWQRPIVTIKIGGQPKEALLDTGADDTVLEEMHLPGKWKPKMIGGIGGFIKVRQYD
QITVEICGHKAIGTVLVGPTPVNITGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005