<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   K101E, Y181C, G190A A98G E28K, K32E, V35T, T39M, K122E, D123N, I135T, I142V, K173A, Q174K, D177E, I178M, T200A, Q207A, V245K  
>11-CP001021| codons 7-255
TVPVKLKPGMDGPKVKQWPLTKEKIEALTEICMEMEKEGKISKIGPENPYNTPVFAIKKK
DSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSVPLDENFRK
YTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEMVICQYVDD
LYVASDLEIGQHRAKIEELRAHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWTVQPIKL
PEKDSWTVN

References
Author Title Citation
Moussa, S First data on HIV-1 resistance mutations to antiretroviral drugs in Central African Republic. ARHR, 2010