<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P95 P95-44 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35L, K49R, R83K, V90I, E169D, T200A  
>P95-44| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEMGQHRAKIEELRQHLLRWGFTTPDKKHRKEPPFLW
>P95-44| G03 | codons 1-229 | clone G03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P95-44| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P95-44| G05 | codons 1-229 | clone G05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P95-44| G09 | codons 1-229 | clone G09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFREIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINDETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDGLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P95-44| G04 | codons 1-229 | clone G04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P95-44| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  N88D T12K, I15V, L19V, K20M, L63P, H69Q  
>P95-44| G02 | codons 1-99 | clone G02
PQITLWQRPLVKIKVGGQVMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
>P95-44| G03 | codons 1-99 | clone G03
PQITLWQRPLVKIKVGEQVMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
>P95-44| G06 | codons 1-99 | clone G06
PQITLWQRPLVKIKVGGQVMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
>P95-44| G05 | codons 1-99 | clone G05
PQITLWQRPLVKIKVGGQVMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
>P95-44| G04 | codons 1-99 | clone G04
PQITLWQRPLVKIKVGGQVMEALLDTGADGTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
>P95-44| G09 | codons 1-99 | clone G09
PQITLWQRPLVKIKVGGQVMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
>P95-44| codons 1-99
PQITLWQRPLVKIKVGGQVMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005