<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13IV, I15V, G16A, K20R, E35D, M36I, N37D, K45R, R57K, D60E, Q61N, L63I, C67E, H69K, K70R, I72E, V82I, L89M  
>40-0837F7| codons 1-99
PQITLWQRPVVTVKVAGQLREALLDTGADDTVLEDIDLPGRWKPRMIGGIGGFIKVKQYE
NIIIEIEGKRAEGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Moussa, S First data on HIV-1 resistance mutations to antiretroviral drugs in Central African Republic. ARHR, 2010