<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, E35D, M36I, R41K, K43R, L63H, H69K, I72M, L89M  
>62-BAW1| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QIHIEICGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V F116Y Y181C   V35T, E36D, T39K, K43E, K49R, S68G, K173T, Q174K, D177E, V179I, Q207A, R211S, H221Y, V245K A129AV
>62-BAW1| codons 11-246
KLKPGMDGPKVKQWPLTEEKIKALTDICKEMEEEGKISRIGPENPYNTPVFAIKKKDGTK
WRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPLDKDFRKYTVF
TIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRTKNPEIIICQYVDDLYVG
SDLEIGQHRTKIEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWTVQPIKL

References
Author Title Citation
Moussa, S First data on HIV-1 resistance mutations to antiretroviral drugs in Central African Republic. ARHR, 2010