<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7 52-293-F12 Central African Republic 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   V35K, T39D, V60I, I135T, I142V, K173A, Q174K, D177E, T200A, Q207G, R211K, D218E M41V
>52-293-F12| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICDEVEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPEKKHQKEPPFLWMGYELHPDKWT
VQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, L19I, K20I, E35Q, M36I, N37D, R41K, I64L, C67S, H69K, V82I, L89M G49GR
>52-293-F12| codons 1-99
PQITLWQRPLVTVKVGGQIIEALLDTGADDTVLEQIDLPGKWKPKMIGRIGGFIKVRQYD
QILLEISGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Moussa, S First data on HIV-1 resistance mutations to antiretroviral drugs in Central African Republic. ARHR, 2010