<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4 23-CP001745 Central African Republic 2008 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210W   K101E, Y181C, G190S   V35T, T39L, T107S, K122E, D123S, K173A, D177G, T200A, Q207E, R211K  
>23-CP001745| codons 21-233
VKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLEKKKSVSVLDVGDAYFSVPLDESFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPGIVICQYVDDLYVSSDLEIGQHRA
KIEELREHLWKWGFTTPDKKHQKEPPFLWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16A, M36I, R41K, H69Q, L89M  
>23-CP001745| codons 1-99
PQITLWQRPIVTVKIAGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Moussa, S First data on HIV-1 resistance mutations to antiretroviral drugs in Central African Republic. ARHR, 2010