<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3 38-0147M1 Central African Republic 2008 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N V108I V35T, T39Q, D121H, K122E, I142V, A158S, K173S, D177E, G196E, T200K, Q207A, R211S  
>38-0147M1| codons 12-244
LKPGMDGPKVKQWPLTEEKIKALTEICQEMEKEGKISKIGPENPYNTPVFAIKKKDSTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPLHEDFRKYTAFT
IPSINNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRSQNPEIVIYQYMDDLYVGS
DLEIEQHRKKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>38-0147M1| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Moussa, S First data on HIV-1 resistance mutations to antiretroviral drugs in Central African Republic. ARHR, 2010