<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P91 P91-85 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 83

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215I K103N P225H T39A, S48T, K122E, S162C  
>P91-85| B01 | codons 1-229 | clone B01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW
>P91-85| B04 | codons 1-229 | clone B04
PISPIGTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMGDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW
>P91-85| B03 | codons 1-229 | clone B03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW
>P91-85| B06 | codons 1-229 | clone B06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW
>P91-85| B02 | codons 1-229 | clone B02
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICVEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW
>P91-85| B08 | codons 1-229 | clone B08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW
>P91-85| B07 | codons 1-229 | clone B07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEPPFLW
>P91-85| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10V, I15V, E35D, M36I, N37D, R57K, L63P, A71V, I93L  
>P91-85| B06 | codons 1-99 | clone B06
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-85| B02 | codons 1-99 | clone B02
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-85| B07 | codons 1-99 | clone B07
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLAGPTPANIIGRNLMTQLGFTLNF
>P91-85| B01 | codons 1-99 | clone B01
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-85| B08 | codons 1-99 | clone B08
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKVIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-85| B03 | codons 1-99 | clone B03
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-85| B04 | codons 1-99 | clone B04
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVKVRQYG
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-85| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005