<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35Q, M36I, N37D, R41K, R57K, L63S, C67E, H69K, V82I, L89M  
>HP24| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYD
QISIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, K122E, D123G, I135V, S162C, K173R, Q174K, D177E, I178M, T200V, Q207N, R211K, K223Q, V245K, E248D, D250E, A272P, T286A, E291D, V292I, I293V, S322T, I326V, Q334P, G335D, F346Y, R356K, M357R, R358G, G359S, Q394R, A400V, E413D, Q428R, K431T, V435P, F440Y  
>HR24| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPEMVI
YQYMDDLYVGSDLEIGQHRVKIEELRNHLLKWGFTTPDKKHQQEPPFLWMGYELHPDKWT
VQPIKLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGPDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIRKETWEVWWTEYWQATWIPDWEFVNTP
PLVKLWYRLETEPIPGAETY

References
Author Title Citation
Ajoge, HO Drug resistance pattern of HIV type 1 isolates sampled in 2007 from therapy-naive pregnant women in north-central Nigeria. ARHR, 2012