<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 EFV+NRTI 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   G190S   D123E, S162C, Q174E, D177E, I178L, Q207N, K238KR, V245M, A272T, K277R, T286A, I293V, E297A, E312R, R356K, G359S, A360T, S468H, H483Y, K512Q, L517I, A554S  
>121770H_wk9| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKENPELVI
YQYMDDLYVSSDLEIGQHRTKIEELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYTGIKVRQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKRPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRST
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVHLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESEIVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Brehm, JH Failure of initial therapy with two nucleosides and efavirenz is not associated with early emergence of mutations in the C-terminus of HIV-1 reverse transcriptase. JAIDS, 2011
Riddler, SA Class-sparing regimens for initial treatment of HIV-1 infection. N Engl J Med, 2008