<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P83 P83-72 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E, G190A   K102R, K122P, K173G, Q174K, R211K  
>P83-72| B05 | codons 1-229 | clone B05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRGKNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P83-72| B06 | codons 1-229 | clone B06
PISPIETVPVKLKPGMNGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P83-72| B01 | codons 1-229 | clone B01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRGKNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P83-72| B04 | codons 1-229 | clone B04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRGKSPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P83-72| B07 | codons 1-229 | clone B07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREKNPDIVI
YQYMDDLYVASDLEIGQHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLW
>P83-72| B08 | codons 1-229 | clone B08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPKNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEREKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQG*KGSPAIFQSSMTKILEPFRGKNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P83-72| B02 | codons 1-229 | clone B02
PISPIETVPVKLRPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRGKNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P83-72| B03 | codons 1-229 | clone B03
PISPIETVPVKLKPGMDGPKVKQWPLTEGKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELDKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRGKNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P83-72| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRGKNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    D60E, L63P, I72T, V77I  
>P83-72| B08 | codons 1-99 | clone B08
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P83-72| B06 | codons 1-99 | clone B06
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P83-72| B07 | codons 1-99 | clone B07
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P83-72| B01 | codons 1-99 | clone B01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P83-72| B05 | codons 1-99 | clone B05
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P83-72| B02 | codons 1-99 | clone B02
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P83-72| B03 | codons 1-99 | clone B03
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P83-72| B04 | codons 1-99 | clone B04
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P83-72| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005