<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG95522 RG95522w68 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 58
2 None 6
3 3TC+AZT+LPV 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I62V, L63P, G68E, A71T, V77VI, I93L  
>RG95522w68| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICEHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Riddler, SA Class-sparing regimens for initial treatment of HIV-1 infection. N Engl J Med, 2008