<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 2
2 None 11

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48T, K103R, K122E, S162C, Q174K, Q207E, R211K, A272S, T286A, I293V, E297A, E312T, G335E, R356K, M357V, E404D, V435A, K454R, T470A, H483Y, L491S, Q507H, K512R, L517I, S519N, V531I, A554AS  
>610834La| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKTPVHGVYYDPSKDLIAEIQKQGQEQWTYQIYQEPFKNLKTGKYAKVRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGRAGYVTDRGRQKVVSLADTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIHAQPDRSESEIVNQIIEQLIKKEKIYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, L63Q, I64V, H69Y, I72V  
>610834La| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGYKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Riddler, SA Class-sparing regimens for initial treatment of HIV-1 infection. N Engl J Med, 2008
Brehm, JH Failure of initial therapy with two nucleosides and efavirenz is not associated with early emergence of mutations in the C-terminus of HIV-1 reverse transcriptase. JAIDS, 2011