<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+LPV+TDF 16
2 None 20
3 3TC+LPV+TDF 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, T31TP, E35D, M36I, R41K, R57K, L63P, H69K, L89M, I93L T26TS
>RG82111w55| codons 10-99
LVTIKIEGQLKEALLDSGADDPVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIPIEICGK
KAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I       E6D, K11T, V35T, T39E, V60I, S68G, V106I, K122E, D123S, K173R, Q174K, D177E, I178M, T200A, E203D, Q207A, R211S, K238R, V245E, D250E, V276I, T286A, E291D, V292I, I293V, K311Q, E312T, I326V, I329V, Q332QR, M357N, G359S, K366R, A371V, K388R, K390R, K395R, E399D W239R
>RG82111w55| codons 1-399
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEMVI
YQYIDDLYVGSDLEIGQHRAKIDELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRRT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILQTPVHGVYYDPSKDLVAEVQKRGQGQWTYQIYQEPFKNLKTGKYARNRSA
HTNDVRQLTEVVQKIATESIVIWGKTPRFRLPIQRETWD

References
Author Title Citation
Riddler, SA Class-sparing regimens for initial treatment of HIV-1 infection. N Engl J Med, 2008