<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P70 P70-44 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N P225H V21I, K122S, I135L, S162C, E169D, D177E, G196E  
>P70-44| G04 | codons 1-229 | clone G04
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSVPL
DSDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P70-44| G01 | codons 1-229 | clone G01
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DSDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P70-44| G03 | codons 1-229 | clone G03
PISPTETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DSDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P70-44| G05 | codons 1-229 | clone G05
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DSDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P70-44| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DSDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHKTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P70-44| G02 | codons 1-229 | clone G02
PISPIETIPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DSDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P70-44| G07 | codons 1-229 | clone G07
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIEALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DSDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW
>P70-44| codons 1-229
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DSDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10I, R41K, I62V, L63P, I93L  
>P70-44| G07 | codons 1-99 | clone G07
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>P70-44| G01 | codons 1-99 | clone G01
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>P70-44| G03 | codons 1-99 | clone G03
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>P70-44| G05 | codons 1-99 | clone G05
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>P70-44| G06 | codons 1-99 | clone G06
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>P70-44| G02 | codons 1-99 | clone G02
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>P70-44| G04 | codons 1-99 | clone G04
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>P70-44| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005