<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 EFV+LPV 137

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2P, I13V, K14R, G17E, K20I, E35K, M36I, R41K, H69K, L89M  
>RG60650w137| codons 1-99
PPITLWQRPLVTVRIGEQLIEALLDTGADDTVLEKINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   E6D, K11A, I31L, V35T, S48E, K49R, V60I, D123N, K173T, Q174K, D177E, I178M, Q207E, R211K, V245Q, D250E, A272P, T286A, E291D, V292I, I293V, R307K P217PS
>RG60650w137| codons 1-308
PISPIDTVPVALKPGMDGPKVKQWPLTEEKLKALTEICTEMEKEGKIERIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTSDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENKE

References
Author Title Citation
Riddler, SA Class-sparing regimens for initial treatment of HIV-1 infection. N Engl J Med, 2008