<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 EFV+LPV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101EQ, G190S   V35I, S68G, K122P, T139V, I195T, Q207K, R211RK, V245M, K249KQ, K275Q, V276I, T286A, A288S, I293V, E297A, E312N, D324E, E328ED, Q334E, F346Y, R356RK, M357T, V365VI, A376S, K390R  
>RG56473w17| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNEVPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLETGQHRTKIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEQDSWTVNDIQKLVGKLNWASQIYAGIQIKQLCKLLRGAKSLTEVVPLTAEAE
LELAENREILKNPVHGVYYDPSKELIADIQKQGEGQWTYQIYQEPYKNLKTGKYAKTRGA
HTNDIKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV   I15V, E35D, M36I, I62V, L63P  
>RG56473w17| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Riddler, SA Class-sparing regimens for initial treatment of HIV-1 infection. N Engl J Med, 2008